Immunomodulating drugs

Specificity Synaptophysin Immunogen Synthetic peptide from human synaptophysin. Application Anti-Synaptophysin Antibody detects level of Synaptophysin &amp has been published &amp validated for use in WB, IH(P).

Synaptopodin (SYNPO) is an actin-associated protein that may play an important role in modulating actin-based shape and motility of dendritic spines and renal podocyte foot processes. It is expressed in the cerebral cortex.

Immunogen synaptopodin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to synaptopodin Sequence LTTPPSSNSRGVQLFNRRRQRVNEFTLESHGQRGQKPSQESLRVLPSSLPGHAPGLSLSSTSLPEPGPPRHPSPQSPDRGVPGHSMEGYSEEASLLRHLEK Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen synaptopodin 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen synaptopodin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen synaptopodin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

SYNPO2L, also known as Synaptopodin 2-like protein, is a member of the synaptopodin family. SYNPO2L was initially identified as a novel heart-enriched gene that encodes a cytoskeletal protein highly expressed in the Z-disc of heart and skeletal

Immunogen synaptopodin 2-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen synaptopodin 2-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen synaptoporin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen synaptoporin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The