Immunomodulating drugs

Syntaphilin (SNPH) is a single-pass membrane protein that was initially identified in a yeast two-hybrid screen with the carboxy terminal region of Syntaxin-1 as bait. Syntaxin-1 is a key component of the synaptic vesicle docking machinery that

alpha-Synuclein is a small (140 amino acid) cytoplasmic protein of unclear function that is enriched in presynaptic terminals and is the precursor protein of a nonamyloid beta component of senile plaques in Alzeheimer&#8242s Disease (AD).

alpha -Synuclein is a small (140-amino acid) cytoplasmic protein of unclear function that is enriched in presynaptic terminals and is the precursor protein of a nonamyloid beta component of senile plaques in Alzeheimer&#8242s Disease (AD). alpha

Specificity Recognizes alpha synuclein. Immunogen Synthetic peptide corresponding amino acids 116-131 of human alpha synuclein.

Immunogen Synthetic peptide corresponding amino acids 108-120 of human alpha synuclein. Application Anti-Synuclein Antibody, &#945 is an antibody against Synuclein for use in IH(P).

Immunogen TGF-beta activated kinase 1/MAP3K7 binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen TGF-beta activated kinase 1/MAP3K7 binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to TGF-beta activated kinase 1/MAP3K7 binding protein 2 Sequence QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDTEDDEGAQWNC Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Recombinant protein corresponding to TGF-beta activated kinase 1/MAP3K7 binding protein 2 Sequence HSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSS Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen TGF-beta activated kinase 1/MAP3K7 binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen mitogen-activated protein kinase kinase kinase 7 interacting protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen TGF-beta activated kinase 1/MAP3K7 binding protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive