-
HPA011732-100UL
Anti-TCAF1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen TRPM8 channel-associated factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA038756-100UL
Anti-TCAF2 antibody produced in rabbit (C15-1455-428)
Price: $928.29List Price: $1,031.43Immunogen TRPM8 channel associated factor 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA038758-100UL
Anti-TCAF2 antibody produced in rabbit (C15-1455-429)
Price: $928.29List Price: $1,031.43Immunogen TRPM8 channel associated factor 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
AV48227-100UL
Anti-TCAP (AB1) antibody produced in rabbit
Price: $898.29List Price: $998.10TCAP codes for a protein that binds to titin and acts as a substrate for titin kinase, thereby playing an important role in sarcomere assembly. Genetic mutations in Tcap have been linked to cardiomyopathies. -
HPA043786-100UL
Anti-TCEA1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transcription elongation factor A (SII), 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA043836-100UL
Anti-TCEA2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transcription elongation factor A (SII), 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA060384-100UL
Anti-TCEAL1 antibody produced in rabbit (C15-1463-526)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to transcription elongation factor A like 1 Sequence MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA076762-100UL
ANTI-TCEAL1 ANTIBODY PRODUCED IN RABBIT (C15-1466-941)
Price: $977.14List Price: $1,085.71Immunogen transcription elongation factor A like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA058982-100UL
Anti-TCEAL3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transcription elongation factor A (SII)-like 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA045564-100UL
Anti-TCEAL5 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transcription elongation factor A (SII)-like 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA051507-100UL
Anti-TCEAL7 antibody produced in rabbit (C15-1460-689)
Price: $928.29List Price: $1,031.43Immunogen transcription elongation factor A (SII)-like 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA065080-100UL
Anti-TCEAL7 antibody produced in rabbit (C15-1464-810)
Price: $928.29List Price: $1,031.43Immunogen transcription elongation factor A (SII)-like 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive