-
Add to Cart The item has been addedHPA027019-100ULAnti-TMPPE antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Putative metallophosphoesterase FLJ45032 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been added654250-1MGAnti-TNF-alpha Rabbit pAb (C15-1307-370)
Price: $1,193.14List Price: $1,325.71Rabbit polyclonal antibody purified by ammonium sulfate precipitation. Recognizes recombinant and monocyte-derived TNF-α. -
Add to Cart The item has been addedHPA013333-100ULAnti-TNFAIP1 antibody produced in rabbit (C15-1447-952)
Price: $879.43List Price: $977.14TNFAIP1 (tumor necrosis factor, alpha-induced protein 1) was first discovered as an interleukin-6 (IL-6) and tumor necrosis factor (TNF) α-inducible protein. It is a highly conserved protein and is conserved across humans, rat and C. -
Add to Cart The item has been addedHPA014641-100ULAnti-TNFAIP1 antibody produced in rabbit (C15-1448-198)
Price: $879.43List Price: $977.14TNFAIP1 (tumor necrosis factor, α-induced protein 1) was first discovered as an interleukin-6 (IL-6) and tumor necrosis factor (TNF) α-inducible protein. It is a highly conserved protein and is conserved across humans, rat and C. -
Add to Cart The item has been addedHPA002116-100ULAnti-TNFAIP3 antibody produced in rabbit (C15-1445-532)
Price: $879.43List Price: $977.14Immunogen Tumor necrosis factor, alpha-induced protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA067479-100ULAnti-TNFAIP3 antibody produced in rabbit (C15-1465-310)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to TNF alpha induced protein 3 Sequence AEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREV Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA054434-100ULAnti-TNFAIP8 antibody produced in rabbit (C15-1461-679)
Price: $928.29List Price: $1,031.43Immunogen tumor necrosis factor, alpha-induced protein 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA057089-100ULAnti-TNFAIP8 antibody produced in rabbit (C15-1462-551)
Price: $928.29List Price: $1,031.43Immunogen tumor necrosis factor, alpha-induced protein 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA077484-100ULAnti-TNFAIP8L3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to TNF alpha induced protein 8 like 3 Sequence PAARSMDSDSGEQSEGEPVTAAGPDV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA006404-100ULAnti-TNFRSF14 antibody produced in rabbit
Price: $879.43List Price: $977.14TNFRSF14 (tumor necrosis factor receptor superfamily, member 14) gene is localized to human chromosome 1p36.22-36. -
Add to Cart The item has been addedAP1159-100UGAnti-TNFRSF14 Mouse mAb (2G6-2C7) (C15-1319-092)
Price: $794.88List Price: $883.20Purified mouse monoclonal antibody. Recognizes the TNFRSF14 protein. -
Add to Cart The item has been addedHPA004102-100ULAnti-TNFRSF1A antibody produced in rabbit
Price: $977.14List Price: $1,085.71Immunogen Tumor necrosis factor receptor superfamily member 1A precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)
