Immunomodulating drugs

The TOX high mobility group box family member 3 (TOX3) gene with seven exons, is mapped to human chromosome 16q12. The encoded protein is mainly expressed in brain and breast.

The TOX high mobility group box family member 3 (TOX3) gene with seven exons, is mapped to human chromosome 16q12. The encoded protein is mainly expressed in brain and breast.

Immunogen tumor protein D52 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen tumor protein D52 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen tumor protein D52-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen TP53RK binding protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

The gene TPRN (taperin) is mapped to human chromosome 9q34. In mouse, TPRN is expressed in the inner ear, the organ of Corti and is present within the supporting cells and inner ear hair cell stereocilia.

Immunogen taperin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

Immunogen transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen Recombinant protein corresponding to TNFRSF1A associated via death domain Sequence NGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRVLQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

TRAF2 (TNF receptor associated factor 2) is one of the six members of the TRAF family. It is an adaptor protein, and is composed of a conserved TRAF domain in its C-terminal and a RING finger domain in its N-terminal.

Immunogen TNF receptor-associated factor 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are