Immunomodulating drugs

Immunogen tripartite motif containing 52 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

TRIM54 (Tripartite motif containing 54) is a novel muscle specific RING finger protein belonging to theTRIM protein superfamily. It consists of highly conserved N-terminal RING domains, coiled-coil region and one or two B-box motifs.

Tripartite motif containing 66 (TRIM66) or transcription intermediate factor 1&#948 is part of the tripartite motif (TRIM)-containing protein family. It has a plant homeodomain (PHD) along with a bromodomain at the carboxy terminal.

Signal transducer and activator of transcription 3 (UniProt P40763 also known as Acute-phase response factor, DNA-binding protein APRF) is encoded by the STAT3 (also known as ADMIO, APRF, HIES) gene (Gene ID 6774) in human. STAT proteins are

Immunogen TRIO and F-actin-binding protein recombinant protein epitope signature tag (PrEST) Application Anti-TRIOBP antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each

TRIOBP (TRIO and F-actin binding protein) is a putative cytoskeleton-associated protein localized to hair cell stereocilia rootlets. It is located to chromosome 22q13.

Immunogen thyroid hormone receptor interactor 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to thyroid hormone receptor interactor 10 Sequence QIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRGDSLSRHARPPDPPASAPPDSSSNSASQDTKESSEE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Recombinant protein corresponding to thyroid hormone receptor interactor 10 Sequence LQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen thyroid hormone receptor interactor 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen thyroid hormone receptor interactor 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen thyroid hormone receptor interactor 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive