-
HPA053097-100UL
Anti-TSEN54 antibody produced in rabbit (C15-1461-234)
Price: $928.29List Price: $1,031.43Immunogen tRNA splicing endonuclease 54 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA042681-100UL
Anti-TSHB antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to thyroid stimulating hormone beta Sequence CAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGF Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA006982-100UL
Anti-TSHZ1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Teashirt homolog 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA038123-100UL
Anti-TSHZ2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen teashirt zinc finger homeobox 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA008834-100UL
Anti-TSHZ3 antibody produced in rabbit (C15-1447-233)
Price: $879.43List Price: $977.14TSHZ3 (teashirt zinc finger homeobox 3) is a homeobox protein, which belongs to the 3-member Teashirt family. This protein is composed of multiple zinc finger motifs, with wide spaces between them. -
HPA071010-100UL
ANTI-TSHZ3 ANTIBODY PRODUCED IN RABBIT (C15-1465-944)
Price: $977.14List Price: $1,085.71Immunogen teashirt zinc finger homeobox 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
ABF113
Anti-TSLP Antibody (C15-1317-259)
Price: $687.43List Price: $763.81Thymic stromal lymphopoietin (TSLP) has recently been identified as an important factor capable of driving dendritic cell maturation and activation. TSLP is a four-helix-bundle cytokine that is expressed mainly by barrier epithelial cells and is a -
ABT330
Anti-TSLP Antibody (C15-1318-048)
Price: $828.00List Price: $920.00Thymic stromal lymphopoietin (TSLP) has recently been identified as an important factor capable of driving dendritic cell maturation and activation. TSLP is a four-helix-bundle cytokine that is expressed mainly by barrier epithelial cells and is a -
ABT334
Anti-TSLP receptor Antibody (C15-1318-052)
Price: $828.00List Price: $920.00Thymic stromal lymphopoietin (TSLP) receptor is a member of the Type I cytokine receptor family (type 5 subfamily). TSLP has been shown to play an important role in dendritic cell maturation and activation. -
HPA031054-100UL
Anti-TSNAX antibody produced in rabbit (C15-1452-954)
Price: $928.29List Price: $1,031.43Immunogen translin-associated factor X recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA031055-100UL
Anti-TSNAX antibody produced in rabbit (C15-1452-955)
Price: $928.29List Price: $1,031.43Immunogen translin-associated factor X recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA053516-100UL
Anti-TSNAXIP1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen translin-associated factor X interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive