-
Add to Cart The item has been addedHPA042074-100ULAnti-WDR7 antibody produced in rabbit (C15-1457-049)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA051057-100ULAnti-WDR7 antibody produced in rabbit (C15-1460-511)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to WD repeat domain 7 Sequence PASDSFRSDVGKAVENLIPPVQHILLDRKDKELLICPPVTRFFYGCREYFHKLLIQGDSSGRLNIWNISDTADKQGSEEGLAMTTSISLQEAFDKLNP Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA048212-100ULAnti-WDR72 antibody produced in rabbit (C15-1459-495)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 72 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA057410-100ULAnti-WDR72 antibody produced in rabbit (C15-1462-653)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 72 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA059819-100ULAnti-WDR72 antibody produced in rabbit (C15-1463-380)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 72 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA039357-100ULAnti-WDR73 antibody produced in rabbit
Price: $928.29List Price: $1,031.43WD repeat domain 73 (WDR73) belongs to WD repeat domain family of proteins. The motif contains 40-60 amino acids with tryptophan (W) and aspartate (D). -
Add to Cart The item has been addedHPA037795-100ULAnti-WDR74 antibody produced in rabbit (C15-1454-909)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 74 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA038419-100ULAnti-WDR74 antibody produced in rabbit (C15-1455-239)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 74 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA038199-100ULAnti-WDR75 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 75 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA040626-100ULAnti-WDR76 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 76 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA026437-100ULAnti-WDR77 antibody produced in rabbit (C15-1451-057)
Price: $879.43List Price: $977.14WD repeat domain 77 (WDR77) is a 44kDa protein which consists of 342 amino acids. It is a subunit of the survival of motor neuron (SMN) complex and the gene encoding it is localized on human chromosome 1. -
Add to Cart The item has been addedHPA026448-100ULAnti-WDR77 antibody produced in rabbit (C15-1451-065)
Price: $879.43List Price: $977.14WD repeat domain 77 (WDR77) is a 44kDa protein which consists of 342 amino acids. It is a subunit of the survival of motor neuron (SMN) complex and the gene encoding it is localized on human chromosome 1.
