-
HPA031769-100UL
Anti-ZBTB8A antibody produced in rabbit (C15-1453-269)
Price: $889.20List Price: $988.00Immunogen zinc finger and BTB domain containing 8A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA031770-100UL
Anti-ZBTB8A antibody produced in rabbit (C15-1453-270)
Price: $889.20List Price: $988.00Immunogen zinc finger and BTB domain containing 8A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA055553-100UL
Anti-ZBTB8B antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger and BTB domain containing 8B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA046315-100UL
Anti-ZBTB8OS antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger and BTB domain containing 8 opposite strand recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA036767-100UL
Anti-ZBTB9 antibody produced in rabbit (C15-1454-537)
Price: $928.29List Price: $1,031.43Immunogen zinc finger and BTB domain containing 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA058171-100UL
ANTI-ZBTB9 ANTIBODY PRODUCED IN RABBIT (C15-1462-852)
Price: $977.14List Price: $1,085.71Immunogen zinc finger and BTB domain containing 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA065062-100UL
Anti-ZC2HC1C
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger C2HC-type containing 1C Sequence SRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEWVQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQK Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
HPA039236-100UL
Anti-ZC3H10 antibody produced in rabbit (C15-1455-635)
Price: $928.29List Price: $1,031.43Immunogen zinc finger CCCH-type containing 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA062265-100UL
Anti-ZC3H10 antibody produced in rabbit (C15-1464-036)
Price: $928.29List Price: $1,031.43Immunogen zinc finger CCCH-type containing 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
ABF292
Anti-ZC3H12A Antibody (C15-1317-306)
Price: $785.14List Price: $872.38Ribonuclease ZC3H12A, also known as MCP-induced protein 1 or Zinc finger CCCH domain-containing protein 12A, and encoded by the gene name ZC3H12A or MCPIP, is an essential member of a family of novel CCCH-zinc finger proteins that regulate -
HPA032052-100UL
Anti-ZC3H12A antibody produced in rabbit (C15-1453-359)
Price: $889.20List Price: $988.00Immunogen zinc finger CCCH-type containing 12A recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies ® are highly characterized and extensively validated antibodies with the added benefit of all available -
HPA032053-100UL
Anti-ZC3H12A antibody produced in rabbit (C15-1453-360)
Price: $889.20List Price: $988.00Immunogen zinc finger CCCH-type containing 12A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive