-
HPA040847-100UL
Anti-ZC3H18 antibody produced in rabbit (C15-1456-389)
Price: $928.29List Price: $1,031.43Immunogen zinc finger CCCH-type containing 18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA041327-100UL
Anti-ZC3H18 antibody produced in rabbit (C15-1456-635)
Price: $967.37List Price: $1,074.86Immunogen zinc finger CCCH-type containing 18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA023658-100UL
Anti-ZC3H3 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zinc finger CCCH domain-containing protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA040934-100UL
Anti-ZC3H4 antibody produced in rabbit (C15-1456-432)
Price: $977.14List Price: $1,085.71Immunogen zinc finger CCCH-type containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA041068-100UL
Anti-ZC3H4 antibody produced in rabbit (C15-1456-504)
Price: $928.29List Price: $1,031.43Immunogen zinc finger CCCH-type containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA036019-100UL
Anti-ZC3H6 antibody produced in rabbit (C15-1454-131)
Price: $928.29List Price: $1,031.43Immunogen zinc finger CCCH-type containing 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA036020-100UL
Anti-ZC3H6 antibody produced in rabbit (C15-1454-132)
Price: $928.29List Price: $1,031.43Immunogen zinc finger CCCH-type containing 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA076065-100UL
Anti-ZC3H6 antibody produced in rabbit (C15-1466-822)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger CCCH-type containing 6 Sequence ISGSYITSKKGQHNKKFKSKEYDEYSTYSDDNFGNYSDDNFGNYGQETEEDFANQLKQYRQAKETSNIALGSSFSKESGKKQRMKGVQQGI Application All Prestige Antibodies Powered by Atlas Antibodies -
HPA040808-100UL
Anti-ZC3H7A antibody produced in rabbit (C15-1456-367)
Price: $928.29List Price: $1,031.43Immunogen zinc finger CCCH-type containing 7A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA059849-100UL
Anti-ZC3H7A antibody produced in rabbit (C15-1463-390)
Price: $928.29List Price: $1,031.43Immunogen zinc finger CCCH-type containing 7A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA001784-100UL
Anti-ZC3H7B antibody produced in rabbit (C15-1445-409)
Price: $879.43List Price: $977.14Zinc finger CCCH-type containing 7B (ZC3H7B) is 110kDa cellular protein, also termed as rotavirus X protein associated with NSP3 (RoXaN). It consists of mainly three regions which are involved in the protein-protein or nucleic acid-protein -
HPA076092-100UL
ANTI-ZC3H7B ANTIBODY PRODUCED IN RABBIT (C15-1466-827)
Price: $977.14List Price: $1,085.71Immunogen zinc finger CCCH-type containing 7B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization