-
Add to Cart The item has been addedAV36244-100ULAnti-ZFP42 antibody produced in rabbit
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human ZFP42 Biochem/physiol Actions ZFP42, also known as REX1 and ZNF754, is a zinc finger protein and a marker of pluripotent stem cells. It is expressed in placenta during -
Add to Cart The item has been addedHPA047172-100ULAnti-ZFP57 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 57 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedAV37763-100ULAnti-ZFP589 antibody produced in rabbit
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the middle region of human ZFP589 Biochem/physiol Actions The function of Anti-ZFP589 has not yet been determined. Sequence Synthetic peptide located within the following region: -
Add to Cart The item has been addedHPA048629-100ULAnti-ZFP62 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 62 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedAV39337-100ULAnti-ZFP64 (AB1) antibody produced in rabbit
Price: $759.43List Price: $843.81ZFP64 is a zinc-finger protein that enhances p65 stimulation and thereby promotes TLR-induced production of pro-inflammatory cytokines and type I interferons in macrophages. Rabbit Anti-ZFP64 antibody recognizes bovine, canine, human, and pig ZFP64. -
Add to Cart The item has been addedHPA035112-100ULAnti-ZFP64 antibody produced in rabbit (C15-1453-698)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 64 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA058387-100ULAnti-ZFP64 antibody produced in rabbit (C15-1462-931)
Price: $928.29List Price: $1,031.43Immunogen ZFP64 zinc finger protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA027808-100ULAnti-ZFP69 antibody produced in rabbit (C15-1451-616)
Price: $879.43List Price: $977.14Immunogen zinc finger protein 642 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA054942-100ULAnti-ZFP69 antibody produced in rabbit (C15-1461-836)
Price: $928.29List Price: $1,031.43Immunogen ZFP69 zinc finger protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA051669-100ULAnti-ZFP82 antibody produced in rabbit (C15-1460-747)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ZFP82 zinc finger protein Sequence NHGLKGLILKNDWESTGKIEGQERPQEGYFSSVKMPSEKVSSYQKRTSVTPHQRLH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA060470-100ULAnti-ZFP82 antibody produced in rabbit (C15-1463-548)
Price: $928.29List Price: $1,031.43Immunogen ZFP82 zinc finger protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA029017-100ULAnti-ZFP90 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen zinc finger protein 90 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
