-
HPA034575-100UL
Anti-ZIM3 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen zinc finger, imprinted 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
ABF197
Anti-ZIP-8 Antibody (C15-1317-289)
Price: $642.86List Price: $714.29Zinc transporter ZIP8 (UniProt Q9C0K1 also known as BCG-induced integral membrane protein in monocyte clone 103 protein, LIV-1 subfamily of ZIP zinc transporter 6, LZT-Hs6, Solute carrier family 39 member 8, ZIP-8, Zrt- and Irt-like protein 8) is -
HPA003201-100UL
Anti-ZKSCAN5 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen zinc finger with KRAB and SCAN domains 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA003483-100UL
Anti-ZKSCAN8 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 192 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA012827-100UL
Anti-ZMAT1 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene ZMAT1 encoding zinc finger matrin-type protein-1 is mapped to human chromosome X. Immunogen Zinc finger matrin-type protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies -
HPA036518-100UL
Anti-ZMAT2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger, matrin type 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
AV50793-100UL
Anti-ZMAT3 antibody produced in rabbit (C15-1341-804)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human ZMAT3 Application Anti-ZMAT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml. -
HPA028671-100UL
Anti-ZMAT3 antibody produced in rabbit (C15-1451-950)
Price: $879.43List Price: $977.14Immunogen zinc finger, matrin-type 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA054356-100UL
Anti-ZMAT3 antibody produced in rabbit (C15-1461-652)
Price: $928.29List Price: $1,031.43Immunogen zinc finger, matrin-type 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA056671-100UL
Anti-ZMAT4 antibody produced in rabbit (C15-1462-417)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger matrin-type 4 Sequence MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA069813-100UL
Anti-ZMAT4 antibody produced in rabbit (C15-1465-759)
Price: $928.29List Price: $1,031.43Immunogen zinc finger, matrin-type 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA004858-100UL
Anti-ZMAT5 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zinc finger matrin-type protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are