Immunomodulating drugs

Specificity Recognizes AANAT (Arylalkylamine N-acetyltransferase). The antibody specifically recognizes the phosphorylated N-terminal PKA site of AANAT (pT31) (Ganguly et al.

Immunogen aminoadipate-semialdehyde dehydrogenase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen aminoadipate-semialdehyde dehydrogenase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Radial glia play key roles in neuronal migration, axon guidance, and neurogenesis during development of the central nervous system. However, the molecular mechanisms regulating growth and morphology of these extended cells are unknown.

Immunogen ATP-binding cassette, sub-family A (ABC1), member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ATP-binding cassette, sub-family A (ABC1), member 13 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

ABCA3 (ATP-binding cassette, sub-family A, member3) gene encodes a member of the ABCA subclass of ATP-binding cassette (ABC) transporters. Its expression is restricted to lungs in the type II cells expressing surfactant protein A.

Immunogen ATP binding cassette subfamily A member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

ABCA5 (ATP binding cassette subfamily A member 5) is a member of ATP-binding cassette subfamily A (ABCA) transporters. It is highly expressed in several location of human brain such as neurons, moderately in microglia and at a lesser amount in

Immunogen Recombinant protein corresponding to ATP binding cassette subfamily A member 5 Sequence DQQLVYSLPFKDMDKFSGLFSALDSHSNLGVISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKASLVSTMS Application All Prestige Antibodies Powered by

Immunogen ATP-binding cassette, sub-family A (ABC1), member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ATP-binding cassette, sub-family A (ABC1), member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive