Immunomodulating drugs

ATP-binding cassette sub-family A member 7 (ABCA7), also known as ABCA-SSN and Macrophage ABC transporter, is a full-size ABC transporter consisting of two sets of the multiple membrane-spanning domains plus the Walker motifs for the ATP

The ATP binding cassette subfamily A member 7 (ABCA7) gene, spanning ~32kb with 46 exons, is mapped to human chromosome 19p13.3.

Immunogen ATP-binding cassette, sub-family A (ABC1), member 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen Recombinant protein corresponding to ATP binding cassette subfamily A member 9 Sequence NCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEYGYR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen ATP-binding cassette, sub-family A (ABC1), member 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen ATP-binding cassette, sub-family B (MDR/TAP), member 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen ATP-binding cassette, sub-family B (MDR/TAP), member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen ATP-binding cassette, sub-family B (MDR/TAP), member 6 (Langereis blood group) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunohistochemistry (1

ATP binding cassette subfamily B member 7 transporter protein (ABCB7) is located in mitochondrial inner membrane and encoded by ABACB7 gene on human chromosome Xq13.3.

Immunogen ATP-binding cassette, sub-family B (MDR/TAP), member 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen ATP-binding cassette, sub-family B (MDR/TAP), member 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen ATP-binding cassette, sub-family B (MDR/TAP), member 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project