Immunomodulating drugs

Immunogen Immunogen Sequence: GI # 4501913 , sequence 72-144 Recombinant ADAM metallopeptidase domain 23 preproprotein Application Anti-ADAM23 antibody produced in chicken is suitable for western blotting analysis at a dilution of 1:500, for tissue

The adhesion and degranulation adaptor protein (ADAP) acts as an adapter protein of the FYN and LCP2 signaling cascades in T-cells. ADAP modulates the expression of interleukin-2 (IL-2) and it is suggested to be involved in platelet activation.

Immunogen Arf-GAP with dual PH domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Sequence PKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQKAVDRPMLPQEYAVE Application All Prestige

Immunogen Arf-GAP with dual PH domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

The gene adenosine deaminase, RNA specific (ADAR)/ ADAR1, spanning ~30Kbp on genomic DNA, is mapped to human chromosome 1q21.3.

Immunogen adenosine deaminase, RNA-specific Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen adenosine deaminase, tRNA-specific 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen adenosine deaminase, tRNA-specific 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen adenosine deaminase, tRNA-specific 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen adenylate cyclase 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Immunogen Sequence: GI # 10181096 , sequence 1-121 Recombinant adenylate cyclase 6 isoform a Application Anti-ADCY6 antibody produced in chicken is suitable for western blotting analysis at a dilution of 1:500, for tissue or cell staining

Immunogen adenylate cyclase 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by