Immunomodulating drugs

Immunogen AF4/FMR2 family, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen AF4/FMR2 family, member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

AFM (afamin) is a 75kDa vitamin E-binding glycoprotein belonging to the albumin gene family. It consists of four or five potential N-glycosylation sites.

Immunogen Recombinant protein corresponding to afamin Sequence EMEKLVKDMVEYKDRCMADKTLPECSKLPNNVLQEKICAMEGLPQKHNFSHCCSKVDAQRRLCFFYNKKSDVGFLPPFPTLDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCEEQNKVNCLQTRAIPV Application All Prestige Antibodies

AFMID, kynurenine formamidase also called arylformamidase, is located on human chromosome 17q25.3.

Immunogen Immunogen Sequence: GI # 4501989 , sequence 180-420 Recombinant &#945-fetoprotein Application Anti-AFP antibody produced in chicken is suitable for western blotting analysis at a dilution of 1:500, for tissue or cell staining at a

AFP (&#945 fetoprotein) is a 70kDa serum glycoprotein, and is produced during gestation from fetal liver and yolk sac. Immunogen &#945-Fetoprotein precursor recombinant protein epitope signature tag (PrEST) Application Anti-AFP antibody produced

The gene AFP (alpha fetoprotein) encodes a plasma glycoprotein that has a molar mass of 70kDa. The gene is mapped to human chromosome 4.

Immunogen aftiphilin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen aftiphilin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Forkhead box O4 (FOXO4) belongs to the FOXO transcription factor family that regulates growth, cell cycle, metabolism, stress tolerance, aging and apoptosis in cells. Studies have reported that USP7 modulates FOXO4 transcription.

Specificity AGE (Advanced Glycation End-products) Immunogen Glycoaldehyde-modified protein. Application Anti-AGE (Advanced Glycation End-products) Antibody detects level of AGE (Advanced Glycated End-products) &amp has been published &amp