Immunomodulating drugs

Monoclonal Anti-HNRNPC Prestige Antibodies &#174 Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen

Monoclonal Anti-HNRNPC Prestige Antibodies &#174 Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen

Binds human IgG does not bind other human Igs.The antibody is specific for a determinant on the heavy chain of human IgG.

Binds human IgG does not bind other human Igs.The antibody is specific for a determinant on the heavy chain of human IgG.

Human IgG consists of four subclasses (1-4) that can be recognized by antigenic differences in their heavy chains. They constitute approximately 65, 30, 5 and 4% of the total IgG, respectively.

Immunogen laminin, alpha 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Recombinant protein corresponding to Lim homeobox 2 Sequence KRKSPGPGADLAAYNAALS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Calpain small subunit 1 (Capns1) is a small regulatory subunit associated with the &#956-calpain (calpain 1) and m-calpain (calpain 2). The CAPNS1 gene is mapped to human chromosome 19q13.

Immunogen myelin oligodendrocyte glycoprotein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Myelin oligodendrocyte glycoprotein (MOG) is usually present at the extracellular surface of myelin sheaths and oligodendrocytes in the central nervous system. The human MOG gene is located 60 kilobases (kb) telomeric to HLA-F (major

Immunogen Recombinant protein corresponding to metadherin. Sequence RKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQD Application All Prestige

Immunogen metadherin Application All Prestige Antibodies &#174 Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease