-
Add to Cart The item has been addedAMAB91508-100ULMONOCLONAL ANTI-MTOR ANTIBODY PRODUCED IN MOUSE (C15-1318-888)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Mechanistic target of rapamycin Sequence DTNTKGNKRSRTRTDSYSAGQSVE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedAMAB91533-100ULMONOCLONAL ANTI-MUC1 ANTIBODY PRODUCED IN MOUSE (C15-1318-899)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to mucin 1, cell surface associated Sequence AVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL Epitope Binds to an epitope located within the peptide sequence RRKNYGQLDIFPARD as -
Add to Cart The item has been addedAMAB91025-100ULMonoclonal Anti-NEFH antibody produced in mouse (C15-1318-648)
Price: $977.14List Price: $1,085.71Immunogen neurofilament, heavy polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedAMAB91314-100ULMonoclonal Anti-NEFL antibody produced in mouse (C15-1318-783)
Price: $977.14List Price: $1,085.71Immunogen neurofilament, light polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedAMAB91511-100ULMONOCLONAL ANTI-NFKB2 ANTIBODY PRODUCED IN MOUSE (C15-1318-889)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Nuclear factor kappa b subunit 2 Sequence LKRKRGGDVSDSKQFTYYP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedAMAB90690-100ULMonoclonal Anti-PBRM1 antibody produced in mouse (C15-1318-504)
Price: $977.14List Price: $1,085.71PBRM1 (polybromo 1) codes for BAF180 protein. It is a subunit of the ATP-dependent chromatin remodeling complex called SWI/SNF (SWItch/sucrose nonfermentable). -
Add to Cart The item has been addedAMAB90988-100ULMonoclonal Anti-PDIA3 antibody produced in mouse (C15-1318-627)
Price: $977.14List Price: $1,085.71Monoclonal Anti-PDIA3 Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and PDIA3 (protein -
Add to Cart The item has been addedAMAB90990-100ULMonoclonal Anti-PDIA3 antibody produced in mouse (C15-1318-628)
Price: $977.14List Price: $1,085.71Monoclonal Anti-PDIA3 Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Protein -
Add to Cart The item has been addedAMAB90991-100ULMonoclonal Anti-PDIA3 antibody produced in mouse (C15-1318-629)
Price: $977.14List Price: $1,085.71Monoclonal Anti-PDIA3 Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Protein -
Add to Cart The item has been addedC8616-200ULMonoclonal Anti-phospho-beta-Catenin (pThr41) antibody produced in mouse
Price: $1,098.86List Price: $1,220.95Monoclonal Anti-phospho-β-Catenin (pThr41) (mouse IgG1 isotype) is derived from the BCT-41 hybridoma produced by the fusion of mouse myeloma cells (NS1 cells) and splenocytes from BALB/c mice. β-catenin belongs to the armadillo family and -
Add to Cart The item has been addedA8076-.5MLMonoclonal Anti-Phosphoserine-Agarose antibody produced in mouse (C15-1315-445)
Price: $965.14List Price: $1,072.38Monoclonal Anti-Phosphoserine (mouse IgG1 isotype) is derived from the hybridoma produced by the fusion of mouse myeloma cells and splenocytes from an immunized mouse. Specificity By ELISA and dot blot, the antibody reacts specifically with -
Add to Cart The item has been addedA1806-.5MLMonoclonal Anti-Phosphotyrosine-Agarose antibody produced in mouse (C15-1314-909)
Price: $951.43List Price: $1,057.14As determined by ELISA and competitive ELISA, the antibody reacts specifically with phosphorylated tyrosine, both as free amino acid or conjugated to carriers such as BSA or KLH. No cross-reactivity is observed with non-phosphorylated tyrosine,
