Immunomodulating drugs

Immunogen Recombinant protein corresponding to angiomotin Sequence PFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPLSARNSQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Amphiphysin is a nerve terminal-enriched protein thought to be involved in synaptic vesicle endocytosis. One of three amphiphysin homologs, amphiphysin II may interact with amphiphysin I in order to regulate synaptic vesicle endocytosis.

Specificity Recognizes a glycoprotein of 18.5-22.

AMPylation is a reversible post-translational modification in which adenosine monophosphate (AMP) derived from ATP is added to threonine and tyrosine (and possibly serine) residues on target proteins. This modification is created by proteins

Specificity Amyloid-beta, 37-42. Immunogen Amyloid-beta 37-42 conjugated to KLH.

Amyloid monomeric proteins can sometimes oligomerize into destructive amyloid fibrils. Amyloidogenic conformations of non-disease related proteins can be created by partial protein misfolding or denaturation.

Amyloid &#946 1-40 is one of several functional peptides (39 to 43 amino acids in length) formed from proteolytic cleavage of the amyloid-beta precursor protein (APP) by the family of secretase enzymes. Although the APP protein is required for a

Immunogen anaphase promoting complex subunit 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen anaphase promoting complex subunit 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen angiogenin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Angiomotin is a cell surface protein that plays a central role in tight junction maintenance and the uptake of proteins at tight junctions but also appears to regulate endothelial cell response and their migration toward growth factors as well as

Angiomotin is a cell surface protein that plays a central role in tight junction maintenance and the uptake of proteins at tight junctions but also appears to regulate endothelial cell response and their migration toward growth factors as well as