Immunomodulating drugs

Immunogen Annexin A11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

The gene annexin A13 (ANXA13) is mapped to human chromosome 8q24.12.

ANXA13 (Annexin A13) is a calcium-dependent, phospholipid-binding protein belonging to the annexin family and a superfamily of calcium/phospholipid-binding proteins. It is specifically expressed in intestinal and kidney epithelial cells.

ANXA13 (Annexin A13) is a calcium-dependent, phospholipid-binding protein belonging to the annexin family and a superfamily of calcium/phospholipid-binding proteins. It is specifically expressed only in intestinal and kidney epithelial cells.

Immunogen Synthetic peptide directed towards the C terminal region of human ANXA2 Biochem/physiol Actions ANXA2 is a calcium-dependent, phospholipid-binding protein that belongs to the annexin family. It is a lipid raft-associated trafficking

Immunogen Synthetic peptide directed towards the N terminal region of human ANXA3 Biochem/physiol Actions ANXA3 is a calcium-dependent, phospholipid-binding protein that belongs to the annexin family. It is an anticoagulant and promotes

Immunogen Synthetic peptide directed towards the C terminal region of human ANXA3 Sequence Synthetic peptide located within the following region: RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD Physical form Purified antibody supplied in 1x PBS

Immunogen Annexin A3 recombinant protein epitope signature tag (PrEST) Application Anti-ANXA3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by

Immunogen Annexin A3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

ANXA4 (annexin A4) gene encodes a protein that is a member of the annexin family of calcium-dependent phospholipid binding proteins. These proteins contain divergent NH2-terminal &#8242head&#8242 domain that confers specific properties to the

Immunogen annexin A5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Annexin A6 (ANXA6) is a Ca 2+ -regulated membrane-binding protein belonging to the conserved annexin protein family. Immunogen Annexin A6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas