Immunomodulating drugs

Immunogen aspartate dehydrogenase domain containing recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen asparaginase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Asporin, periodontal ligament-associated protein 1 (PLAP1), is a member of the family of small leucine-rich proteoglycan (SLRP) family. Asporin is present in the cartilage extracellular matrix (ECM) where it plays a role in collagen mineralization.

Immunogen asparaginase like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen asparaginase like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen ATPase family, AAA domain containing 2B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen ataxia, cerebellar, Cayman type recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Ataxia telangiectasia group D-complementing (ATDC) protein, also known as tripartite motif containing protein 29 (TRIM29), belongs to the TRIM protein family. Studies have shown that ATDC may act as a transcriptional regulatory factor involved in

Anti-ATF3, mouse monoclonal, clone 6B8, recognizes the human ATF3 protein. It is validated for ELISA and Western blotting.

Immunogen Synthetic peptide directed towards the N terminal region of human ATF5 Sequence Synthetic peptide located within the following region: MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGG Physical form Purified antibody supplied in 1x PBS

Immunogen Immunogen Sequence: GI # 4502321 , sequence 1407-1500 Recombinant ATPase Application Anti-ATP7A antibody produced in chicken is suitable for western blotting analysis at a dilution of 1:500, for tissue or cell staining at a dilution of

The Anthrax toxin receptor 1 (also known as Tumor endothelial marker 8, ANTXR1 and ATR) was initially discovered as the tumor endothelial marker (TEM8). This protein, which exists in three isoforms (33, 37, 41, and 63 kDa), is highly expressed in