Afelimomab

Immunogen afadin, adherens junction formation factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen afadin, adherens junction formation factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen afadin, adherens junction formation factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen AF4/FMR2 family, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen AF4/FMR2 family, member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

AFM (afamin) is a 75kDa vitamin E-binding glycoprotein belonging to the albumin gene family. It consists of four or five potential N-glycosylation sites.

Immunogen Recombinant protein corresponding to afamin Sequence EMEKLVKDMVEYKDRCMADKTLPECSKLPNNVLQEKICAMEGLPQKHNFSHCCSKVDAQRRLCFFYNKKSDVGFLPPFPTLDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCEEQNKVNCLQTRAIPV Application All Prestige Antibodies

AFP (&#945 fetoprotein) is a 70kDa serum glycoprotein, and is produced during gestation from fetal liver and yolk sac. Immunogen &#945-Fetoprotein precursor recombinant protein epitope signature tag (PrEST) Application Anti-AFP antibody produced

The gene AFP (alpha fetoprotein) encodes a plasma glycoprotein that has a molar mass of 70kDa. The gene is mapped to human chromosome 4.

Forkhead box O4 (FOXO4) belongs to the FOXO transcription factor family that regulates growth, cell cycle, metabolism, stress tolerance, aging and apoptosis in cells. Studies have reported that USP7 modulates FOXO4 transcription.

Immunogen Fructose-bisphosphate aldolase B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

AMACR (a-methylacyl-CoA racemase) is a 43,304 daltons auxiliary racemase protein expressed in peroxisomes and mitochondria of human liver and fibroblasts. It consists of 382 amino acids, two targeting signals, a mitochondrial sequence at its N