Ancestim

HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: E, WB, ICC, IF APPLICATIONS: Anosmin antibody can be used for detection of Anosmin by Western blot at 1 &#956g/mL. Antibody can also be used for immunocytochemistry starting at 5

8-Anilino-1-naphthalene Sulfonic Acid is a hydrophobic polarity sensitive fluorescent dye useful as a site probe to detect conformational changes in cell and micelle membranes and molecules such as proteins. ANSA is also used as a fluorescent probe

Specificity Recognizes rat Anion Exchanger 1 (AE1). The immunogen shows no significant sequence homology with other AE or other proteins.

Immunogen ankyrin repeat domain 35 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Anoctamin 1 (ANO1), a membrane protein, is a member of a protein family with eight transmembrane helices and N- and C-termini. It has two conserved domains, a meiotic segregation-interfering domain, and multiple glycosylation and phosphorylation

Immunogen anoctamin 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen anoctamin 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to anoctamin 2 Sequence EPVSLEARLSRMHFHDSQRKVDYVLAYHYRKRGVHLAQGFPGHSLAIVSNGETGKEPHAGGPGDIELGPLDALEEERKEQREEFEHNLM Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen anoctamin 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen anoctamin 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen anoctamin 6 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1 paper) Features and

Immunogen anoctamin 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most