Antilymphocyte or lymphocyte immune globulin

Immunogen Epithelial-cadherin precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

CDH20 (cadherin 20), also called CDH7L3, is identical to mouse cadherin-7, and is most probably a Xenopus F-cadherin ortholog. This gene is localized to human chromosome 18q22-q23.

Immunogen Cadherin-4 precursor recombinant protein epitope signature tag (PrEST) Sequence YLIDINDNAPELLPKEAQICERPNLNAINITAADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCD Application All Prestige Antibodies Powered by

Immunogen cadherin 7, type 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen chromodomain Y-linked 2B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Synthetic peptide directed towards the N terminal region of human CEBPG Biochem/physiol Actions CCAAT/enhancer binding protein (C/EBP), &#947 (CEBPG) is a transcription factor that regulates transcription mediated by CCAAT/enhancer

Immunogen CCAAT/enhancer-binding protein gamma recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Complement Factor B or CFB is present in the major histocompatibility complex and encodes over 30 protein variants. CFB is an important part of the alternate complement pathway and regulates autoimmune and innate immunological responses .

Immunogen Complement factor B precursor containing complement factor B Ba fragment and complement factor B Bb fragment, recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen complement factor H Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen complement factor H Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Complement factor I precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are