Atlizumab or tocilizumab

Immunogen ataxia, cerebellar, Cayman type recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Ataxia telangiectasia group D-complementing (ATDC) protein, also known as tripartite motif containing protein 29 (TRIM29), belongs to the TRIM protein family. Studies have shown that ATDC may act as a transcriptional regulatory factor involved in

Immunogen Synthetic peptide directed towards the N terminal region of human ATF5 Sequence Synthetic peptide located within the following region: MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGG Physical form Purified antibody supplied in 1x PBS

The Anthrax toxin receptor 1 (also known as Tumor endothelial marker 8, ANTXR1 and ATR) was initially discovered as the tumor endothelial marker (TEM8). This protein, which exists in three isoforms (33, 37, 41, and 63 kDa), is highly expressed in

The gene encoding the protein ataxin-1(ATXN1) is located on chromosome 6p22-p23. It contains the AXH (ataxin-1and HMG-box protein 1 (HBP1)) domain.

Immunogen ataxin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

Immunogen ataxin 2-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen ataxin 2-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen ataxin 2-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen ataxin 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

Immunogen ataxin 3-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen Ataxin-7-like protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported