Blinatumomab

Immunogen forkhead box B2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The farnesoid X receptor (FXR) is a member of the nuclear receptor superfamily and is known to play a key role in bile acid homeostasis. It does through the regulation of key genes involved in bile acid synthesis, metabolism and transport.

Anti-GBA, mouse monoclonal, clone 2E2, recognizes the ~60 kDa GBA in MCF-7 and HeLa cells and human breast cancer tissue. It is validated for use in ELISA, WB, ICC, and IHC on paraffin sections.

Immunogen Synthetic peptide directed towards the C terminal region of human LACTB Biochem/physiol Actions LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome).

Purified mouse monoclonal antibody (see application references). Recognizes the ~72 kDa latent and the ~66 kDa active forms of MMP-2.

Matrix metalloproteinases (MMP&#8242s) are a family of enzymes that are responsible for the degradation of extracellular matrix components such as collagen, laminin and proteoglycans. In addition to sequence homology, all MMP&#8242s share the

Matrix metalloproteinases (MMP&#8242s) are a family of enzymes that are responsible for the degradation of extracellular matrix components such as collagen, laminin and proteoglycans. In addition to sequence homology, all MMP&#8242s share the

Purified mouse monoclonal antibody (see application references). Recognizes both the ~92 kDa latent and the ~83 kDa active forms of MMP-9.

Immunogen Pre-B-cell leukemia transcription factor 1 recombinant protein epitope signature tag (PrEST) Sequence PRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGV Application All

Immunogen Pre-B-cell leukemia transcription factor 1 recombinant protein epitope signature tag (PrEST) Sequence

Immunogen pre-B-cell leukemia homeobox 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

PBX3 is a homeobox transcription factor that shares homology with the human proto-oncogene, PBX1. It is known to enhance the transcriptional functions of HOX proteins and can also modulate developmental genes.