Briakinumab

RNA demethylase ALKBH5 is also known as Alkylated DNA repair protein alkB homolog 5 and Alpha-ketoglutarate-dependent dioxygenase alkB homolog 5. ALKBH5 is a dioxygenase that demethylates RNA, specifically N(6)-methyladenosine (m6A) RNA, which

Immunogen alkB homolog 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen alkB homolog 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen branched chain keto acid dehydrogenase E1, beta polypeptide recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen branched chain keto acid dehydrogenase E1 subunit beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Bcl-2-related protein A1 (BCL2A1), also known as protein BFL-1, protein GRS, and Bcl-2-like protein 5 (Bcl2-L-5), is a member of the Bcl-2 family. BCL2A1/BFL-1 can interact with Bax and suppress apoptosis by inhibiting the release of cytochrome c

Immunogen Recombinant protein corresponding to BRCA1, DNA repair associated Sequence GRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Breast cancer susceptibility gene 2 (BRCA2) is mapped to human chromosome 13q12-q13. The protein encoded by this gene is characterized with BRC repeats in exon 11 and a highly conserved radiation sensitive protein 51 (RAD51) binding domain in exon

Immunogen BRCA1/BRCA2-containing complex, subunit 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Bromodomain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Bromodomain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

BRD2 encodes a transcription factor that is a bromodomain containing protein. Brd2/RING3 is known to associate with the chromatin binding domain of LANA-1 in KSHV (Kaposi&#8242s sarcoma-associated herpesvirus)-infected cells.