Brucella antigen

Immunogen ATP-binding cassette, sub-family A (ABC1), member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ATP-binding cassette, sub-family A (ABC1), member 13 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

ABCA3 (ATP-binding cassette, sub-family A, member3) gene encodes a member of the ABCA subclass of ATP-binding cassette (ABC) transporters. Its expression is restricted to lungs in the type II cells expressing surfactant protein A.

Immunogen ATP binding cassette subfamily A member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

ABCA5 (ATP binding cassette subfamily A member 5) is a member of ATP-binding cassette subfamily A (ABCA) transporters. It is highly expressed in several location of human brain such as neurons, moderately in microglia and at a lesser amount in

Immunogen Recombinant protein corresponding to ATP binding cassette subfamily A member 5 Sequence DQQLVYSLPFKDMDKFSGLFSALDSHSNLGVISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKASLVSTMS Application All Prestige Antibodies Powered by

Immunogen ATP-binding cassette, sub-family A (ABC1), member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ATP-binding cassette, sub-family A (ABC1), member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

ATP-binding cassette sub-family A member 7 (ABCA7), also known as ABCA-SSN and Macrophage ABC transporter, is a full-size ABC transporter consisting of two sets of the multiple membrane-spanning domains plus the Walker motifs for the ATP

The ATP binding cassette subfamily A member 7 (ABCA7) gene, spanning ~32kb with 46 exons, is mapped to human chromosome 19p13.3.

Immunogen ATP-binding cassette, sub-family A (ABC1), member 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen Recombinant protein corresponding to ATP binding cassette subfamily A member 9 Sequence NCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEYGYR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human