-
HPA035734-100UL
Sigma-Aldrich
Anti-BCL2L1 antibody produced in rabbit (C15-1453-988)
Price: $928.29List Price: $1,031.43Immunogen BCL2-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA047514-100ULImmunogen B-cell CLL/lymphoma 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA004899-100UL
Sigma-Aldrich
Anti-BCL6 antibody produced in rabbit (C15-1446-314)
Price: $879.43List Price: $977.14BCL6 (B-cell CLL/lymphoma 6) is a nuclear protein, belonging to the BTB/POZ (BR-C, ttk and bab/Pox virus and Zinc finger) domain family of transcription factors. This zinc finger transcription factor has a molecular mass of 95kDa. -
HPA050645-100UL
Sigma-Aldrich
Anti-BCL6 antibody produced in rabbit (C15-1460-373)
Price: $928.29List Price: $1,031.43Immunogen B-cell CLL/lymphoma 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA059147-100UL
Sigma-Aldrich
Anti-BCL6B antibody produced in rabbit (C15-1463-168)
Price: $928.29List Price: $1,031.43Immunogen B-cell CLL/lymphoma 6, member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA075112-100UL
Sigma-Aldrich
Anti-BCL6B antibody produced in rabbit (C15-1466-675)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to B-cell CLL/lymphoma 6B Sequence YLQMEHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA019762-100ULImmunogen B-cell CLL/lymphoma 7A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
-
HPA049943-100UL
Sigma-Aldrich
Anti-BCL7B antibody produced in rabbit (C15-1460-141)
Price: $928.29List Price: $1,031.43Immunogen B-cell CLL/lymphoma 7B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA058069-100UL
Sigma-Aldrich
Anti-BCL7B antibody produced in rabbit (C15-1462-817)
Price: $928.29List Price: $1,031.43Immunogen B-cell CLL/lymphoma 7B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA018676-100UL
Sigma-Aldrich
Anti-BCL7C antibody produced in rabbit (C15-1449-074)
Price: $879.43List Price: $977.14The gene BCL7C (B-cell CLL/lymphoma 7 protein family member C) is mapped to human chromosome 16p11. It belongs to BCL7 family of proteins. -
HPA052654-100UL
Sigma-Aldrich
Anti-BCL7C antibody produced in rabbit (C15-1461-091)
Price: $928.29List Price: $1,031.43Immunogen B-cell CLL/lymphoma 7C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA020274-100ULImmunogen B-cell CLL/lymphoma 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by