Brucella antigen

Immunogen Immunogen Sequence: GI # 5031617 , sequence 21-210 Recombinant zinc finger protein 256 bone marrow zinc finger 3 Physical form Solution in phosphate buffered saline containing 0.02% sodium azide.

Immunogen basonuclin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen basonuclin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to basonuclin 1 Sequence EKEAVEIANEKRHNLSSDEDMPLQVVSEDEQEACSPQSHRVSEEQHVQSGGLGKPFPEGERPCHRESVIESSG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

The gene basonuclin-2 (BNC2) is mapped to human chromosome 9p22. It belongs to basonuclin zinc-finger family of transcription factors.

Immunogen Recombinant protein corresponding to basonuclin 2 Sequence STQNEYNESSESEVSPTPYKNDQTPNRNALTSITNVEPKTEPACVSPIQNSAPVSDLTKTEHPKSSFRIHRMRRMGSASRKGRVFCNA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Vesicle transport protein SEC20 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen BCL2/adenovirus E1B 19kDa interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (BNIP2) contains protein–protein interaction domain, the BNIP-2 and Cdc42GAP homology (BCH) domain, in the C-terminus. Endogenous BNIP-2 is expressed in Golgi apparatus, early and recycling

Immunogen BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like recombinant protein epitope signature tag (PrEST) Application Anti-BNIP3L antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein

BNIPL (BCL2/adenovirus E1B 19kD interacting protein like) is a novel proapoptotic protein belonging to the BNIPL family. It consists of a BNIP-2 and Cdc42GAP homology (BCH) domain.