Contagious bovine pleuropneumonia CBPP vaccines

Protein Dos (C19orf26) is an integral membrane glycoprotein. It is strongly expressed in brain, pancreatic islets and neuroendocrine cells.

Immunogen claudin domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to clusterin like 1 Sequence HLRNDSNSGNMKPPLLVFIVCLLWLKDSHCAPTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen CNDP dipeptidase 2 (metallopeptidase M20 family) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen CNDP dipeptidase 2 (metallopeptidase M20 family) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

CNOT2 forms a part of the transcriptional regulator, the Ccr4-Not complex, and can repress promoter functions. Studies have reported that depletion of CNOT2 inhibits CCR4-NOT deadenylase and causes apoptosis in cells.

Immunogen CCR4-NOT transcription complex, subunit 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen copine V recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Plexin-B2 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

BOVINE CORPUS STRIATUM, Non-sterile, Tissue, No expiration date is given for this product if properly stored.

Cell Line Origin Bovine lung endothelium Cell Line Description BPAEC is susceptible to bovine respiratory viruses and is positive for BVDV. Application Virus studies: bovine respiratory viruses Culture Medium DMEM or 199 + 2mM Glutamine + 15%

PrEST Antigen BSND barttin CLCNK type accessory beta subunit