-
Add to Cart The item has been addedHPA002116-100ULSigma-Aldrich
Anti-TNFAIP3 antibody produced in rabbit (C15-1445-532)
Price: $879.43List Price: $977.14Immunogen Tumor necrosis factor, alpha-induced protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA067479-100ULSigma-Aldrich
Anti-TNFAIP3 antibody produced in rabbit (C15-1465-310)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to TNF alpha induced protein 3 Sequence AEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREV Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA059857-100ULImmunogen tumor necrosis factor (ligand) superfamily, member 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA008902-100ULSigma-Aldrich
Anti-URB2 antibody produced in rabbit (C15-1447-256)
Price: $879.43List Price: $977.14URB2 (unhealthy ribosome biogenesis protein 2) is localized to nucleolus. Immunogen Unhealthy ribosome biogenesis protein 2 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies -
Add to Cart The item has been addedHPA046788-100ULSigma-Aldrich
Anti-URB2 antibody produced in rabbit (C15-1458-998)
Price: $928.29List Price: $1,031.43Immunogen URB2 ribosome biogenesis 2 homolog (S. cerevisiae) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAb006495-100μgMouse anti Human CD48 Antibody, Monoclonal (156-4H9), could be used for Flow and so on. :Application: Flow: 0.25 μg/100w cells :Protein Function: Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in -
Add to Cart The item has been addedAb006495-10μgMouse anti Human CD48 Antibody, Monoclonal (156-4H9), could be used for Flow and so on. :Application: Flow: 0.25 μg/100w cells :Protein Function: Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in -
Add to Cart The item has been addedAb006495-1mgMouse anti Human CD48 Antibody, Monoclonal (156-4H9), could be used for Flow and so on. :Application: Flow: 0.25 μg/100w cells :Protein Function: Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in -
Add to Cart The item has been addedAb006495-50μgMouse anti Human CD48 Antibody, Monoclonal (156-4H9), could be used for Flow and so on. :Application: Flow: 0.25 μg/100w cells :Protein Function: Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in -
Add to Cart The item has been added4069DARC Antibody, 100 ug UN1687 (C08-0532-818)
Price: $623.39List Price: $692.66HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: E, WB, IHC-P APPLICATIONS: DARC antibody can be used for detection of DARC by Western blot at 0.5 - 2 μg/mL. -
Add to Cart The item has been added4071DARC Antibody, 100 ug UN1687 (C08-0532-819)
Price: $623.39List Price: $692.66HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: E, WB, IHC-P, IF APPLICATIONS: DARC antibody can be used for detection of DARC by Western blot at 0.5 - 2 μg/mL. -
