Daratumumab

Immunogen leucine twenty homeobox recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Recombinant protein corresponding to lymphotoxin beta receptor Sequence EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Melanoma differentiation-associated protein 5 (MDA5), also known as Interferon-induced helicase C domain-containing protein 1 (IFIH1) is a member of the helicase family (RLR subfamily). MDA5 plays an important role in recognizing various viral

Immunogen Synthetic peptide directed towards the middle region of human MDFIC Application Anti-MDFIC (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml.

Immunogen MyoD family inhibitor domain containing recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen MAM domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST) Application Anti-MDGA2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project .

Immunogen mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

NADP-dependent methylenetetrahydrofolate dehydrogenase 2-like protein (MTHFD2L) is an adult mitochondrial MTHFD isozyme present in mammalian cells. The MTHFD2L gene is located on the human chromosome at 4q13.

Immunogen neuroblastoma breakpoint family, member 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive