Defibrotide

Immunogen defensin, beta 132 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Recombinant protein corresponding to defensin beta 136 Sequence GMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Beta Defensin-3 is a novel 5 kDa nonhemolytic antimicrobial protein peptide which may be important in the innate epithelial defense of infections by various microorganisms seen in skin and lung (such as cystic fibrosis). Specificity Recognizes the

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

PrEST Antigen DEF8 differentially expressed in FDCP 8 homolo

Recombinant protein fragment of Human DEFA4 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Application Suitable as a blocking agent using corresponding antibodies.

PrEST Antigen DEFB118 defensin, beta 118, 100ul UN 1687 6.1

PrEST Antigen DEFB129 defensin, beta 129, 100ul UN 1687 6.1

PrEST Antigen DEFB136 defensin beta 136, 100ul UN 1687 6.1 P

PrEST Antigen QDPR quinoid dihydropteridine reductase, 100ul

PrEST Antigen QDPR quinoid dihydropteridine reductase, 100ul

PrEST Antigen RECK reversion-inducing-cysteine-rich protein