Filgrastim

Immunogen filamin A interacting protein 1-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen microRNA 198 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to follistatin like 1 Sequence KCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKTK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen follistatin-like 3 (secreted glycoprotein) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ferritin, light polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

SFRP4 (secreted frizzled-related protein 4) is a protein that regulates the cell growth and differentiation of specific cell types. It can also modulate WNT4 signaling and increase apoptosis during ovulation.

Immunogen secreted frizzled-related protein 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen sphingomyelin phosphodiesterase, acid-like 3A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Corning Fibronectin, human, 5mg, is used as a thin coating on tissue-culture surfaces to promote attachment, spreading, and proliferation of a variety of cell types. The principal functions of fibronectin appear to be in cellular migration during

Other Notes Certified for the analytes listed below. See certificate for values and more details Organic Pollutants / Pesticides Fipronil sulfone, Sum of fipronil and fipronil sulfone expressed as fipronil Matrix Group: Dairy products and eggs

Fibroblast Growth Factor-12(FGF-12) is a heparin binding cytokine belonging to the FGF family. FGF-12 along with FGF-11, -13, and -14, form a sublineage within the FGF family: in contrast to the other members, they are all intracellular signaling

Fibroblast growth factor 13 (FGF13) is a new member of the fibroblast growth factor (FGF) family. They possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell