Gamma IGG or immunoglobulin

Immunogen immunoglobulin superfamily member 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunoglobulin superfamily member 10 precursor (IGSF10) is a 2597 amino acid protein. It contains a signal peptide at the amino-terminal region, leucine-rich repeats (LRRs) and immunoglobulin-like repeats.

Immunogen immunoglobulin superfamily, member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen immunoglobulin superfamily, member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Importin &#946 comprises 19 tandemly repeated Huntingtin, elongation factor 3 (EF3), protein phosphatase 2A (PP2A), and the yeast kinase serine/threonine-protein kinase-TOR1 (HEAT) motifs and wraps around the importin-&#946 (IBB). It also

Immunogen Recombinant protein corresponding to IQ motif containing G Sequence LDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFAVEFNKMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQA Application All Prestige Antibodies Powered by Atlas Antibodies are

Interferon gamma is produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, plays an important role in several immunoregulatory functions.

Neuropilin-1 is a type 1 membrane protein with three distinct functions. First, it can mediate cell adhesion via a heterophilic molecular interaction.

Specificity It is expected that the antibody will also react with rat and mouse. Neuropilin-1.

There are two forms of Neuropilin: Neuropilin-1 and Neuropilin-2. These are non&#8211tyrosine kinase receptors that bind to VEGF and semaphorins (SEMA3A, SEMA3B, and SEMA3F) and play an important role in the critical functioning of the nervous

Immunogen nuclear casein kinase and cyclin-dependent kinase substrate 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen nuclear casein kinase and cyclin-dependent kinase substrate 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most