Immunosupressant antibodies

PAX6 is the most researched of the PAX genes and appears throughout the literature as a master control" gene for the development of eyes and other sensory organs, certain neural and epidermal tissues as well as other homologous structures, usually"

Programmed cell death 11 (PDCD11) is also known as NF (nuclear factor)-&#954B binding protein. The gene encoding it is localized on human chromosome 10q24.

Immunogen programmed cell death 2-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Programmed cell death 6-interacting protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen programmed cell death 6 interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen phosphodiesterase 10A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

The PDE11A gene encodes for a dual-specificity Phosphodiesterase (PDE), which is expressed in the adrenal cortex and is partially inhibited by tadalafil and other PDE inhibitors. PDEs are known to catalyze cAMP and cGMP to 5&#8217-AMP and

Immunogen phosphodiesterase 11A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

The gene PDE3A (phosphodiesterase 3A) encodes a cyclic nucleotide phosphodiesterase that is expressed mainly in cardiac and vascular myocytes and platelets. The cDNA contains a C-terminal catalytic region that spans around 280 amino acids and two

Immunogen phosphodiesterase 3A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

PDE6 (phosphodiesterase 6A) is an &#945-subunit of rod cyclic guanosine monophosphate (cGMP) phosphodiesterase. It is a photoreceptor-specific heterotetrameric protein with two &#945 and &#946 catalytic subunits and two &#947-regulatory

Immunogen Recombinant protein corresponding to phosphodiesterase 6A Sequence EEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVM Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by