Immunosupressant antibodies

Immunogen phosphodiesterase 6D, cGMP-specific, rod, delta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen phosphodiesterase 6D, cGMP-specific, rod, delta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen Recombinant protein corresponding to phosphodiesterase 6H Sequence PRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

PDE9A is a ubiquitous protein belonging to the cyclic nucleotide phosphodiesterase family which regulate the signaling of cyclic nucleotides such as cGMP and cAMP. PDE9A has a higher affinity for cGMP.

Immunogen protein disulfide isomerase family A, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen protein disulfide isomerase family A, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Protein disulfide isomerase family A, member 3 (PDIA3) is a liver microsomal protein with molecular mass of 58kDa. It is associated with the protein disulfide isomerase activity.

PDIA3 (protein disulfide isomerase family A, member 3) is a multi-functional protein, which belongs to the protein-disulfide isomerase family. It is thought to be a membrane receptor for 1,25-dihydroxyvitamin D3 (1&#945,25(OH)2D3), and is

Immunogen Protein disulfide-isomerase A4 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Protein disulfide-isomerase A4 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen protein disulfide isomerase family A, member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen protein disulfide isomerase family A, member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a