Infliximab

Suitable for immunomicroscopy and flow cytometry or FACS analysis as well as other antibody based fluorescent assays requiring extremely low background levels, absence of F(c) mediated binding, lot-to-lot consistency, high titer and specificity.

Suitable for immunomicroscopy and flow cytometry or FACS analysis as well as other antibody based fluorescent assays requiring extremely low background levels, absence of F(c) mediated binding, lot-to-lot consistency, high titer and specificity. The

Suitable for immunomicroscopy and flow cytometry or FACS analysis as well as other antibody based fluorescent assays requiring extremely low background levels, absence of F(c) mediated binding, lot-to-lot consistency, high titer and specificity.

Suitable for immunomicroscopy and flow cytometry or FACS analysis as well as other antibody based fluorescent assays requiring extremely low background levels, absence of F(c) mediated binding, lot-to-lot consistency, high titer and specificity. The

Suitable for immunomicroscopy and flow cytometry or FACS analysis as well as other antibody based fluorescent assays requiring extremely low background levels, absence of F(c) mediated binding, lot-to-lot consistency, high titer and specificity. The

This product is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. This product is also suitable for multiplex analysis, including multicolor imaging, utilizing various commercial

Cell Line Origin Mouse P3X63Ag8.653 x Mouse BALB/c spleen Cell Line Description The antibody is directed against bovine IgA.

Mefluidide is a herbicide widely used to regulate the growth of turf grass and ornamentals. Its primary use is to inhibit cell division in meristematic regions of the plant.

Immunogen neurofilament, light polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to T-box 19 Sequence EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG Epitope Binds to an epitope located within the peptide sequence VLGEPSLTSIAVSTW as determined by

Anti-Alpha Internexin antibody is suitable for use in ELISA, Western Blotting, IHC and IF. Specific conditions for reactivity should be optimized by the end user.

Multidish 6 Well Upcell Cs6