-
CDS006825-25MGOther Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product.
-
760080-250MGApplication This material is used to tune the electronic properties and subsequent surface coverage of gold surfaces/monolayer.
-
852481-1GApplication For a review of the geochemical and biological effects of this riboside, see Adv. Exp.
-
852481-5GApplication For a review of the geochemical and biological effects of this riboside, see Adv. Exp.
-
HPA024470-100ULImmunogen Calpain-2 catalytic subunit Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA046617-100ULImmunogen calpain 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA059749-100ULImmunogen Recombinant protein corresponding to calpain small subunit 2 Sequence KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein
-
HPA003210-100ULImmunogen RIB43A-like with coiled-coils protein 2 recombinant protein epitope signature tag (PrEST) Application Anti-RIBC2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each
-
11074032001Collagenase H is an enzyme mixture prepared from Clostridium histolyticum cultures by filtration, ammonium sulfate precipitation, dialysis, and lyophilization. Specificity Collagenase degrades native collagen.
-
1392002-500MGThis product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the
-
BP773This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the
-
APrEST86178-100
Thomas Scientific
PrEST Antigen CAPN1 calpain 1, (mu/I) large subunit, 100ul U
Price: $537.65List Price: $597.39PrEST Antigen CAPN1 calpain 1, (mu/I) large subunit, 100ul U