Mifamurtide

Lyophilized from 0.02M Ammonium Bicarbonate (may contain traces of buffer salt).

Lyophilized from 0.02M Ammonium Bicarbonate (may contain traces of buffer salt).

Immunogen cytokine induced apoptosis inhibitor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen cytokine induced apoptosis inhibitor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Protein flightless-1 homolog recombinant protein epitope signature tag (PrEST) Sequence KDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAI Application All

Immunogen Protein flightless-1 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen FMRFamide Application Anti-FMRFamide Antibody is an antibody against FMRFamide for use in IH. Immunohistochemistry: 1:1,000 - 1:5,000 Application Notes for Immunohistochemistry: - Suggested perfusion steps: 1) Ca2+-free Tyrode&#8242s

Junctophilin-3 (JPH3, JP-3), also known as Trinucleotide repeat-containing gene 22 protein (TNRC22), is a single-pass type IV membrane protein belonging to the junctophilin family. Junctophilins are important components of the junctional complexes

Immunogen Synthetic peptide directed towards the N terminal region of human JPH3 Application Anti-JPH3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml.

Immunogen junctophilin 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Purified mouse monoclonal antibody. Recognizes the ~85 kDa LRP light chain protein under non-reducing conditions.

MAFA is a tissue specific transcription factor found in the nuclei of pancreas islet beta cells. MAFA specifically binds the insulin enhancer element RIPE3b and activates insulin gene expression.