Muromonab cd3

Application:Flow: 5 μL/test:For flow cytometric staining, the suggested use of this reagent is 5 µL per million cells in 100 µL staining volume or 5 µL per 100 µL of whole blood.

Application:Flow: 5 μL/test:For flow cytometric staining, the suggested use of this reagent is 5 µL per million cells in 100 µL staining volume or 5 µL per 100 µL of whole blood.

Application:Flow: 5 μL/test:For flow cytometric staining, the suggested use of this reagent is 5 µL per million cells in 100 µL staining volume or 5 µL per 100 µL of whole blood.

Cell Line Origin Human acute T lymphoblastic leukaemia Cell Line Description Derived from the peripheral blood of a 19 year old male with acute lymphoblastic leukaemia whilst in relapse. A stable T-cell leukaemia line.

ATP-binding cassette sub-family D member 3 (ABCD3) is a peroxisomal membrane protein belonging to an ATP binding cassette family. The gene encoding it is localized on human chromosome 1p21-22.

Specificity Recognizes the CD3 complex. The epitope recognized by clone no.

CD3e molecule, &#949 (CD3E) is a polypeptide encoded by the CD3E gene in humans. It resides on chromosome 11.

Immunogen CD3e molecule, epsilon (CD3-TCR complex) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen CD3e molecule, epsilon (CD3-TCR complex) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen protein tyrosine phosphatase, receptor type C, recombinant protein epitope signature tag (PrEST) Sequence

Immunogen CD68 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to mucin 1, cell surface associated Sequence AVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL Epitope Binds to an epitope located within the peptide sequence RRKNYGQLDIFPARD as