Muromonab cd3

Chromodomain-helicase-DNA-binding protein 3, more commonly known as CHD-3, is a member of the CHD family of proteins. These proteins are characterized by the presence of chromo (chromatin organization modifier) domain, SNF2-related helicase/ATPase

Immunogen RING finger protein 103 (Zinc finger protein 103 homolog) (Zfp-103) (KF-1) (hKF-1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to charged multivesicular body protein 3 Sequence VNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Chromobox protein homolog 3, also known as Chromobox protein homolog 3 (HECH), Heterochromatin protein 1 homolog gamma (HP1 gamma), or Modifier 2 protein, and encoded by the gene name CBX3, is implied to be involved in transcriptional silencing in

Immunogen C-type lectin domain family 3, member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Chloride intracellular channel protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

The gene CMTM3 (CKLF-like MARVEL transmembrane domain containing 3) encodes a member of the CMTM family that resembles chemokines and the transmembrane-4 superfamily of proteins. It is broadly expressed in normal human adult tissues but is highly

Immunogen Recombinant protein corresponding to CKLF like MARVEL transmembrane domain containing 3 Sequence ADAMQLNDKWQGLCWPMMDFLR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen cAMP responsive element binding protein 3-like 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen cAMP responsive element binding protein 3-like 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

ColorWheel &#174 technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any ColorWheel &#174 antibody with any ColorWheel &#174 dye, researchers can quickly and

ColorWheel &#174 technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any ColorWheel &#174 antibody with any ColorWheel &#174 dye, researchers can quickly and