-
Add to Cart The item has been addedIM1014-50UGAnti-Matriptase/MT-SP1 Rabbit pAb
Price: $469.38List Price: $521.53Immunoaffinity purified rabbit polyclonal antibody. Recognizes the ~75 kDa matriptase protein. -
Add to Cart The item has been addedHPA060363-100ULAnti-MCRIP2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen MAPK regulated corepressor interacting protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA026750-100ULAnti-PILRB antibody produced in rabbit
Price: $879.43List Price: $977.14The paired immunoglobulin-like type 2 receptor β (PILRβ) is a member of PILR family, involved in the regulation of innate immune response in a variety of species. The protein is encoded by a PILRβ gene with four exons and three -
Add to Cart The item has been addedHPA036587-100ULAnti-PIWIL4 antibody produced in rabbit (C15-1454-438)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to piwi like RNA-mediated gene silencing 4 Sequence GRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTGS Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA036588-100ULAnti-PIWIL4 antibody produced in rabbit (C15-1454-439)
Price: $928.29List Price: $1,031.43Immunogen piwi-like 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA057508-100ULAnti-PIWIL4 antibody produced in rabbit (C15-1462-675)
Price: $928.29List Price: $1,031.43Immunogen piwi-like RNA-mediated gene silencing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA063416-100ULAnti-PYCRL antibody produced in rabbit (C15-1464-360)
Price: $928.29List Price: $1,031.43Immunogen pyrroline-5-carboxylate reductase-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA069706-100ULAnti-PYCRL antibody produced in rabbit (C15-1465-731)
Price: $928.29List Price: $1,031.43Immunogen pyrroline-5-carboxylate reductase-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAPrEST78957-100PrEST Antigen PIKFYVE phosphoinositide kinase, FYVE finger c
Price: $537.65List Price: $597.39PrEST Antigen PIKFYVE phosphoinositide kinase, FYVE finger c -
Add to Cart The item has been addedAPrEST91710-100PrEST Antigen PILRA paired immunoglobin-like type 2 receptor
Price: $537.65List Price: $597.39PrEST Antigen PILRA paired immunoglobin-like type 2 receptor -
Add to Cart The item has been addedAPrEST74435-100PrEST Antigen PLCXD1 phosphatidylinositol-specific phospholi
Price: $537.65List Price: $597.39PrEST Antigen PLCXD1 phosphatidylinositol-specific phospholi -
Add to Cart The item has been addedAPrEST80129-100PrEST Antigen PLCXD3 phosphatidylinositol-specific phospholi
Price: $537.65List Price: $597.39PrEST Antigen PLCXD3 phosphatidylinositol-specific phospholi
