-
![[d-lys3]-ghrp-6](https://cdn11.bigcommerce.com/s-2u2oi3cvy8/images/stencil/500x659/products/1027805/855732/cenmed-product-image-placeholder-1-__18071.1717547091.jpg?c=1 "[d-lys3]-ghrp-6")
Add to Cart The item has been addedG4535-5MG[D-Lys3]-GHRP-6
Price: $415.10List Price: $461.22Amino Acid Sequence His-Trp-Lys-Trp-Phe-Lys-NH2 General description [D-Lys 3 ]-GHRP6 (growth hormone releasing peptide 6) is a synthetic analog of the orexigenic peptide hormone called ghrelin. Application [D-Lys3]-GHRP-6 has been used: to study -
Add to Cart The item has been addedHPA039695-100ULAnti-ADH7 antibody produced in rabbit
Price: $928.29List Price: $1,031.43The alcohol dehydrogenase 7 (ADH7) gene is mapped to human chromosome 4q22–23. The gene codes for class IV (σ) alcohol dehydrogenase (ADH). -
Add to Cart The item has been addedHPA041184-100ULAnti-AMDHD2 antibody produced in rabbit (C15-1456-573)
Price: $928.29List Price: $1,031.43Immunogen amidohydrolase domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA041321-100ULAnti-AMDHD2 antibody produced in rabbit (C15-1456-631)
Price: $928.29List Price: $1,031.43Immunogen amidohydrolase domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA003440-100ULAnti-CHCHD10 antibody produced in rabbit
Price: $977.14List Price: $1,085.71CHCHD10 (coiled-coil-helix-coiled-coil-helix domain containing 10) gene is also known as IMMD, SMAJ, FTDALS2, N27C7-4 and C22orf16. It encodes a coiled-coil helix mitochondrial protein localized in the intermembrane space and enriched at cristae -
Add to Cart The item has been addedHPA034688-100ULAnti-CHCHD4 antibody produced in rabbit (C15-1453-512)
Price: $889.20List Price: $988.00Immunogen coiled-coil-helix-coiled-coil-helix domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA063727-100ULAnti-CHCHD4 antibody produced in rabbit (C15-1464-464)
Price: $928.29List Price: $1,031.43Immunogen coiled-coil-helix-coiled-coil-helix domain containing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA050783-100ULAnti-CHCHD7 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen coiled-coil-helix-coiled-coil-helix domain containing 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA012008-100ULAnti-CHD4 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Chromodomain-helicase-DNA-binding protein 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA053075-100ULAnti-CHD7 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromodomain helicase DNA binding protein 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA056216-100ULAnti-D2HGDH antibody produced in rabbit (C15-1462-278)
Price: $977.14List Price: $1,085.71Immunogen D-2-hydroxyglutarate dehydrogenase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA060548-100ULAnti-D2HGDH antibody produced in rabbit (C15-1463-574)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to D-2-hydroxyglutarate dehydrogenase Sequence VTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVS Application All Prestige Antibodies Powered by Atlas Antibodies are
