-
Add to Cart The item has been addedHPA073152-100ULAnti-NACA antibody produced in rabbit (C15-1466-320)
Price: $928.29List Price: $1,031.43Immunogen nascent polypeptide-associated complex alpha subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA073648-100ULAnti-NACA antibody produced in rabbit (C15-1466-415)
Price: $928.29List Price: $1,031.43Immunogen nascent polypeptide-associated complex alpha subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA064055-100ULAnti-NAGPA antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA054898-100ULAnti-NAIF1 antibody produced in rabbit (C15-1461-824)
Price: $928.29List Price: $1,031.43Immunogen nuclear apoptosis inducing factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA064931-100ULAnti-NAIF1 antibody produced in rabbit (C15-1464-772)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to nuclear apoptosis inducing factor 1 Sequence EQQNDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYLQSNTANPAPASDPGQVAQNGQPDSIIQ Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA042438-100ULAnti-NAIP antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen NLR family, apoptosis inhibitory protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA053006-100ULAnti-NARF antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen nuclear prelamin A recognition factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA040017-100ULAnti-NARS antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen asparaginyl-tRNA synthetase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA026793-100ULAnti-NARS2 antibody produced in rabbit
Price: $879.43List Price: $977.14The NARS2 gene with 14 exons is mapped to human chromosome 11q14.1, encodes mitochondrial asparaginyl-tRNA synthetase enzyme, which belongs to aminoacyl-tRNA synthetase (mt-aaRS) family. -
Add to Cart The item has been addedHPA018127-100ULAnti-NAV1 antibody produced in rabbit (C15-1448-935)
Price: $879.43List Price: $977.14Neuron navigator 1 (NAV1) is expressed in the brain during the developmental stages and in the adult heart. The gene encoding this protein is localized on human chromosome 1q32. -
Add to Cart The item has been addedHPA027887-100ULAnti-NAV1 antibody produced in rabbit (C15-1451-645)
Price: $879.43List Price: $977.14Neuron navigator 1 (NAV1) is expressed in the brain during the developmental stages and in the adult heart. The gene encoding this protein is localized on human chromosome 1q32. -
Add to Cart The item has been addedHPA011755-100ULAnti-NAV2 antibody produced in rabbit (C15-1447-637)
Price: $879.43List Price: $977.14Immunogen Neuron navigator 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
