Tabilautide

Immunogen suppressor of defective silencing 3 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen surfeit 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen TGF-beta activated kinase 1/MAP3K7 binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen TGF-beta activated kinase 1/MAP3K7 binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to TGF-beta activated kinase 1/MAP3K7 binding protein 2 Sequence QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDTEDDEGAQWNC Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Recombinant protein corresponding to TGF-beta activated kinase 1/MAP3K7 binding protein 2 Sequence HSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSS Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen TGF-beta activated kinase 1/MAP3K7 binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen mitogen-activated protein kinase kinase kinase 7 interacting protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen TGF-beta activated kinase 1/MAP3K7 binding protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

TAGLN2 (transgelin 2) was first identified as a marker of differentiated smooth muscle. It is expressed in the adult smooth muscle cells and embryonic skeletal and cardiac tissues.

Immunogen transaldolase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen transaldolase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.