Teriflunomide

Immunogen Synthetic peptide directed towards the N terminal region of human IRF4 Biochem/physiol Actions IFN regulatory factor (IRF)-4 is a lymphoid/myeloid-restricted member of the IRF transcription factor family that plays an essential role in

Interferon regulatory factor-4 (IRF4), a transcription factor, is essential for Th (T helper)-2 effector cell differentiation. It belongs to the interferon (IFN) regulatory factor (IRF) transcription factor family.

Immunogen Interferon regulatory factor 4 recombinant protein epitope signature tag (PrEST) Sequence ALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLC

Immunogen neuroligin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen neuroligin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

PAP associated domain containing 5 (PAPD5) belongs to the family of noncanonical poly(A) polymerases. It is located at 16q12.

Immunogen PAP associated domain containing 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

NUMA1 or NUMA protein is an interesting and major component of the nuclear matrix of eukaryotic cells. NUMA1 is a highly abundant protein component that appears to serve a non-structural role but is needed for mitotic spindle poles and centrosome

Immunogen PR domain containing 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Protein tyrosine phosphatase receptor type U (PTPRU) is also termed as purkinje cell protein 2 (PCP2)/ PTP&#955. It belongs to the R2B subfamily of receptor protein tyrosine phosphatases (RPTPs).

Immunogen tandem C2 domains, nuclear recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen transcription elongation factor A (SII), 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a