-
87042206-1VL
Sigma-Aldrich
6-23 (CLONE 6) RAT THYROID CARCINOMA (C15-1311-135)
Price: $1,407.43List Price: $1,563.81Cell Line Origin Rat medullary thyroid carcinoma Cell Line Description Derived from the non-clonal line rMTC 6-23 originally established from a transplantable WAG/RIJ rat medullary thyroid carcinoma. The cell line synthesises and secretes both -
AB3239-IMyostatin, also known as Growth/differentiation factor 8, is a negative regulator of skeletal muscle growth encoded by the MSTN (also known as MSLHP and GDF8) gene in human. Myostatin is a member of the bone morphogenetic protein (BMP) family
-
211731BD Brom Thymol Blue 5 Gm is a reliable and dependable addition to the BD Laboratory Media family of products. Combining top-notch and uncompromising quality.
-
89062107-1VLCell Line Origin Mouse NS1 x Mouse BALB/c spleen Cell Line Description The antibody is directed against Thy-1 present in human brain, with small amounts in kidney. The 23.
-
AMAB90844-100UL
Sigma-Aldrich
Monoclonal Anti-THY1 antibody produced in mouse (C15-1318-563)
Price: $977.14List Price: $1,085.71Immunogen Thy-1 cell surface antigen, recombinant protein epitope signature tag (PrEST) Sequence VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL Epitope Binds to an epitope -
AMAB90846-100UL
Sigma-Aldrich
Monoclonal Anti-THY1 antibody produced in mouse (C15-1318-564)
Price: $977.14List Price: $1,085.71Immunogen Thy-1 cell surface antigen, recombinant protein epitope signature tag (PrEST) Sequence VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL Epitope Binds to an epitope -
APrEST92189-100
Thomas Scientific
PrEST Antigen PTTG1IP pituitary tumor-transforming 1 interac
Price: $537.65List Price: $597.39PrEST Antigen PTTG1IP pituitary tumor-transforming 1 interac -
APrEST90303-100
Thomas Scientific
PrEST Antigen TCF7 transcription factor 7 (T-cell specific, (C08-0222-831)
Price: $537.65List Price: $597.39PrEST Antigen TCF7 transcription factor 7 (T-cell specific, -
APrEST71860-100
Thomas Scientific
PrEST Antigen TMPO thymopoietin, 100ul UN 1687 6.1 PG2 (C08-0207-191)
Price: $537.65List Price: $597.39PrEST Antigen TMPO thymopoietin, 100ul UN 1687 6.1 PG2 -
APrEST95052-100
Thomas Scientific
PrEST Antigen TMPO thymopoietin, 100ul UN 1687 6.1 PG2 (C08-0226-634)
Price: $537.65List Price: $597.39PrEST Antigen TMPO thymopoietin, 100ul UN 1687 6.1 PG2 -
APrEST73801-100
Thomas Scientific
PrEST Antigen TOX thymocyte selection-associated high mobili (C08-0208-779)
Price: $537.65List Price: $597.39PrEST Antigen TOX thymocyte selection-associated high mobili -
APrEST93125-100
Thomas Scientific
PrEST Antigen TOX thymocyte selection-associated high mobili (C08-0225-294)
Price: $537.65List Price: $597.39PrEST Antigen TOX thymocyte selection-associated high mobili