-
ABC139
Anti-TSPO Antibody (C15-1316-630)
Price: $828.00List Price: $920.00Translocator protein (TSPO) is also called Mitochondrial benzodiazepine receptor, PKBS, or Peripheral-type benzodiazepine receptor (PBR). TSPO generates peripheral-type benzodiazepine recognition sites. -
HPA000530-100UL
Anti-TYMP antibody produced in rabbit (C15-1444-967)
Price: $879.43List Price: $977.14Immunogen thymidine phosphorylase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA001072-100UL
Anti-TYMP antibody produced in rabbit (C15-1445-150)
Price: $879.43List Price: $977.14The gene TYMP (thymidine phosphorylase) is mapped to human chromosome 22q13.33. -
HPA041899-100UL
Anti-TYROBP antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen TYRO protein tyrosine kinase binding protein recombinant protein epitope signature tag (PrEST) Sequence FLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA029641-100UL
Anti-TYW3 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
APrEST73519-100
PrEST Antigen BMPR2 bone morphogenetic protein receptor, typ (C08-0208-535)
Price: $537.65List Price: $597.39PrEST Antigen BMPR2 bone morphogenetic protein receptor, typ -
APrEST91171-100
PrEST Antigen BMPR2 bone morphogenetic protein receptor, typ (C08-0223-554)
Price: $537.65List Price: $597.39PrEST Antigen BMPR2 bone morphogenetic protein receptor, typ -
APrEST71722-100
PrEST Antigen IMPAD1 inositol monophosphatase domain contain
Price: $537.65List Price: $597.39PrEST Antigen IMPAD1 inositol monophosphatase domain contain -
APrEST73155-100
PrEST Antigen NEMP1 nuclear envelope integral membrane prote
Price: $537.65List Price: $597.39PrEST Antigen NEMP1 nuclear envelope integral membrane prote -
APrEST91471-100
PrEST Antigen NFATC2IP nuclear factor of activated T-cells,
Price: $537.65List Price: $597.39PrEST Antigen NFATC2IP nuclear factor of activated T-cells, -
APrEST72291-100
PrEST Antigen PTPN2 protein tyrosine phosphatase, non-recept (C08-0207-544)
Price: $537.65List Price: $597.39PrEST Antigen PTPN2 protein tyrosine phosphatase, non-recept -
APrEST85547-100
PrEST Antigen PTPRQ protein tyrosine phosphatase, receptor t
Price: $537.65List Price: $597.39PrEST Antigen PTPRQ protein tyrosine phosphatase, receptor t